Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Six Star Services II Inc.Report or remove this logo

Six Star Services II Inc. federal contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary XHXQRLAYAJX6· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8DEU5· Houston, TX· Active registration until Apr 24, 2027· www.orchestramacro.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$738KFA3002 338 ESS CC$738K · Air Force officeSix Star Services II Inc.$738K
Awards toSix Star Services II Inc.ConnectedCircle area = dollars

Insight FA3002 338 ESS CC is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2020–FY2026

$787K

No prime awards in FY2026 so far

About

From the company's SBA profile, updated Apr 2026

Orchestra Macrosystems? is a software company focused on multi-disciplinary capability assessment. Twenty-first century combat hinges on the speed at which a force can move to its next maneuver, and requires that decisions be made faster than in any previous warfighting style. Assessing readiness in a dynamic, multi-domain operations environment requires intelligent measurement tools that ingest and analyze a diverse array of data inputs simultaneously. To meet these requirements, Orchestra Macrosystems developed a proprietary scoring and record-keeping software suite, which FORSCOM piloted at Fort Bliss in September 2019 to administer the Army Combat Fitness Test across multiple battalions.

Prime contract obligations by fiscal year, US$, FY2020–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY20$795KFY21FY25−$7,883

Insight Largest year: $795K in FY2020; since FY2021, $0 in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$738K since award = −$7,883 in FY2021–FY2026 + $746K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Texas$738K · 100%
Circle area = dollarsOutlined: head office state (Texas)

Insight 100% was performed in Texas. See more on the Contracts tab