Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Spe Systems Inc. Federal Contracts

Correct this listing

Doing business as SPE SYSTEMS INC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary XHV9WQJNE2D6· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 94DS1· ALDIE, VA· Active registration until Sep 9, 2027· www.spe-systems.com (opens in a new tab)

Overview

Buyers and offices that award Spe Systems prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyMissile Defense Agency$500MISSILE DEFENSE AGENCY (MDA)(HQ0853)$500 · Missile Defense Agency officeSpe Systems Inc.$500
Awards toSubcontracts toCircle area = dollars

Insight MISSILE DEFENSE AGENCY (MDA) (HQ0853) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2026

$500

Includes FY2026 so far: $500, still being reported

About

From the company's SBA profile, updated Sep 2026

SPE Systems Inc. provides systems engineering and integration services and specializes in architecture solutions, modeling, simulation & analysis, R&D, prototyping and testing as well as risk management. SPE is proficient in agile and lean multi-domain environments across all warfighting domains (e.g., land, maritime, air, space, and cyberspace). SPE delivers innovative solutions that explore the unknown and push the boundaries of what is possible. SPE is committed to excellence, continually challenging conventional thinking and seeking out cutting-edge technologies and methodologies. By fostering a culture of creativity and forward-thinking, we aim to uncover new opportunities and solve complex problems.

Prime contract obligations by fiscal year, US$, FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY26$500 so far

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Alabama$500 · 100%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 100% was performed in Alabama. See more on the Contracts tab