Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Spin Global Limited Liability Company federal contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary F1BJV7SERB55· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 7G3Q4· Cheverly, MD· Active registration until Oct 31, 2026

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyOffice of ProcurementOperations$784KSCI TECH ACQ DIV (70RSAT)$784K · Office of Procurement Operatio…Spin Global Limited Liability Company$784K
Awards toSpin Global Limited Liability CompanyConnectedCircle area = dollars

Insight SCI TECH ACQ DIV (70RSAT) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2017–FY2026

$784K

No prime awards in FY2026 so far; last obligations in FY2021

Subcontracts it received

$2.2M

from 2 primes

About

From the company's SBA profile, updated Nov 2025

The SPIN Global organization is a Washington D.C. based start-up company. SPIN Global's team has traversed 30+ nations providing non-profit and global humanitarian relief, led national-level flagship homeland security and emergency preparedness initiatives for the U.S. government, and has experience implementing solutions with 40+ states, 300+ local agencies and private sector companies including but not limited to special event management, disaster operations, and multi-jurisdictional exercises. We help public and private sector agencies improve their ability to perform the function of coordination through catalytic technologies that help to modernize their disaster risk reduction and emergency preparedness programs. We provide consulting services, develop world class information products, leverage existing systems and develop third party applications, integrate mission critical technologies, provide operational and technical training.

Prime contract obligations by fiscal year, US$, FY2017–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY17$490KFY18FY21−$229

Insight Largest year: $490K in FY2017; since FY2021, −$229 in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$784K since award = −$229 in FY2021–FY2026 + $784K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
Circle area = dollarsOutlined: head office state (Maryland)

Insight 100% was performed in District of Columbia. See more on the Contracts tab