Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Steigerwaldt Land Services Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary FZ5TE2LJMXW3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 1D7G1· TOMAHAWK, WI· Active registration until May 1, 2027

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyForest Service$167KUSDA FOREST SERVICE-SPOC EAST(124419)$67.8K · Forest Service officeUSDA-FS, STEWARDSHIP CONTRACTINGBRANCH (12363N)$53.6K · Forest Service officeUSDA-FS, CSA EAST 7 (124446)$46.1K · Forest Service officeSteigerwaldt Land Services Inc.$167K
Awards toSubcontracts toCircle area = dollars

Insight USDA FOREST SERVICE-SPOC EAST (124419) is its largest buyer. See more on the Buyers tab

3 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2005–FY2026

$305K

About

From the company's SBA profile, updated May 2026

Real Estate Appraisals, Timber Inventory, Property Damage Appraisals, Expert Witness, Forestland Management, Natural Resource and Environmental Management, Resource Studies, Analytic and Investment Strategies, Forest Carbon Modeling and Inventories, Carbon Market Connections, Real Estate Brokerage, GIS Mapping and Database Solutions, Right of Way Eminent Domain Appraisals and Acquistions, Land Surveying, Natural Resource and Environmental Management

Prime contract obligations by fiscal year, US$, FY2005–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY05FY07$98KFY08FY19FY21FY22FY23FY24FY25−$141

Insight Largest year: $98K in FY2007; since FY2021, $71.9K in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Wisconsin$108K · 64%
  2. Michigan$59.9K · 36%
Circle area = dollarsOutlined: head office state (Wisconsin)

Insight 64% was performed in Wisconsin. See more on the Contracts tab