Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Strategic Grove LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary EJ4EK4KQR2Q3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 9BVH7· SALAMANCA, NY· Active registration until Aug 19, 2027

Part of Seneca Nation Of Indians (opens another page) (parent company) · One of 17 registrations

Overview

Buyers and offices that award Strategic Grove prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyU.S. Secret Service$8.72MU. S. SECRET SERVICE (70US09)$8.72M · U.S. Secret Service officeStrategic Grove LLC$8.72M
Awards toSubcontracts toCircle area = dollars

Insight U. S. SECRET SERVICE (70US09) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2023–FY2026

$6.75M

Includes FY2026 so far: $2.69M, still being reported

About

From the company's SBA profile, updated Sep 2026

Strategic Grove, a certified Tribal 8(a) company, combines the strength of its two partners, Oak Grove Technologies and Seneca Strategic Partners, to deliver quality training, services, and product solutions to civilian and military organizations across the globe. We are leading the way in multi-domain training, web-based and platform instruction learning solutions, regional/cultural and language expertise, information technology, and intelligence services. Our capabilities, customer-first organizational culture, and personnel talent makes us the ideal partner to deliver quality on every project.

Prime contract obligations by fiscal year, US$, FY2023–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY23FY24FY25$2.08MFY26$2.69M so far

Insight Largest year: $2.08M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$8.72M since award = $6.75M in FY2021–FY2026 + $1.97M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. District of Columbia$8.69M · 99%
  2. Maryland$29.7K · 0.3%
Circle area = dollarsOutlined: head office state (New York)

Insight 99% was performed in District of Columbia. See more on the Contracts tab