Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Sustainment & Restoration Services, LLC federal contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary JJM5BPY5NUK1· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6VBP0· Milwaukee, WI· Active registration until Aug 6, 2027

Part of Oneida Nation (opens another page) (parent company) · One of 25 registrations · Company group: Sustainment & Restoration Services, LLC (2 registrations)

Overview

Buyers, this company and its subcontractors, US$, contracts active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026; subcontractors: reported value since award

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companySubcontractorsArmy$201MNavy$28MDefense Media Activity$19.9M7 more$36.4MW075 ENDISTSACRAMENTO (W91238)$123M · Army officeW075 ENDIST LOSANGELES (W912PL)$23.8M · Army officeW075 ENDISTALBUQUERQUE (W912PP)$22.3M · Army office31 more offices$116MSustainment &Restoration Services, LLC$285MHi - Tek Environmental, Inc.$202MEurofins Environment TestingSouthwest, LLC$267KAlaniz Associates Corp.$213KYellow Jacket Drilling Services, LLC$174KEncompass Consultant Group, Inc.$40KOneida Total Integrated EnterprisesLLC$17K2 more$2,948
Awards toSubcontracts toSustainment & Restoration Services, LLCConnectedGroupedCircle area = dollars

Insight Two subcontractorsSubcontractor (sub): a company hired by the prime to do part of a federal contract. It works for the prime, not the government. Glossary received 99% of what it reported subcontracting. See more on the Teaming tab

34 buying officesAll 8 subcontractors

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2015–FY2026

$310M

Includes FY2026 so far: $4.93M, still being reported

Subcontracts it reported, on contracts active FY2021–FY2026

$202M

8 subcontractors

Subcontracts it received

$1.98M

from 4 primes

About

From the company's SBA profile, updated Aug 2026

SRS provides federal agency clients (USACE, NAVFAC, USAF, BIA) environmental compliance, engineering and restoration services worldwide. Work has included: • Comprehensive environmental consulting for installation-wide (Fence-to-Fence) regulatory compliance with CAA, CWA, SPCC, EPCRA, EMS, RCRA, TRI, NEPA, P2, INRMP and ICRMP at nationwide DoD locations including F.E. Warren AFB, WY and Beale AFB, CA • Diversified CERCLA/RCRA (PA/SI, RI/FS, RFA/RFI, RD/RA, Removal Actions, LTO/LTM, Phase I, II, III Assessments and EBS) including High-Resolution Site Characterization • Per- and polyfluoroalkyl substances (PFAS) remedial investigation and response action • Soil and groundwater remediation, treatment system O&M and optimization • Military Munitions Response Services and Operational Range Clearance including: LLRW, RCRA, and Range Residue inspection, processing; ESS development; UXO safety oversight; MEC removal and disposal; MPPEH/MDAS certification, packaging, and recycling

Prime contract obligations by fiscal year, US$, FY2015–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY15FY16FY17FY18FY19FY20FY21FY22FY23$60.9MFY24FY25FY26FY26 so far: $4.93M

Insight Largest year: $60.9M in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$285M since award = $222M in FY2021–FY2026 + $63M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. California$175M · 61%
  2. Maryland$20.8M · 7.3%
  3. Arizona$17.1M · 6.0%
  4. Wisconsin$13M · 4.6%
  5. Tennessee$7.88M · 2.8%

18 smaller, $51.6M together.

Circle area = dollarsOutlined: head office state (Wisconsin)

Insight 61% was performed in California. See more on the Contracts tab