Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Tailored Training Programs LLC Federal Contracts

Correct this listing

Doing business as TAILORED TRAINING PROGRAMS LLC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary W2AXT5CQKYW7· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 4HM93· PINEHURST, NC· Active registration until Feb 11, 2027

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyFederal Bureau ofInvestigation$877KNavy$24.7KFBI-JEH (15F067)$877K · Federal Bureau of Investigation…NCIS QUANTICO VA (N63285)$24.7K · Navy officeTailored Training Programs LLC$902K
Awards toSubcontracts toCircle area = dollars

Insight FBI-JEH (15F067) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2015–FY2026

$3.92M

Subcontracts it received

$20.1M

from 1 prime

About

From the company's SBA profile, updated Mar 2025

TTP has a reputation as a world-class training company, working with elite operators in high-stakes environments leveraging the human domain, human intelligence collection, and specialized readiness training. TTP leverages best practices from academia and industry to build adaptability and capability in operators, equipping them with the most advanced techniques and strategies and immersing them in experience-based training scenarios. At the senior leadership levels, TTP provides broad impacts on organizational performance affecting the ideals of the organization, culture, competencies and expectations for performance. TTP is the industry leader in Science-Based Intelligence and Investigative Interview and staffs high-demand/low-density solutions for our clients. TTP stands ready to support the full cycle of specialized education/training for: leadership development, specialized skills, CI, CT, human dynamics, and leveraging human domain.

Prime contract obligations by fiscal year, US$, FY2015–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY15FY16$1.11MFY17FY18FY19FY20FY21FY23$24.7K

Insight Largest year: $1.11M in FY2016; since FY2021, $88.8K in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$902K since award = $113K in FY2021–FY2026 + $788K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. North Carolina$877K · 97%
  2. Virginia$24.7K · 2.7%
Circle area = dollarsOutlined: head office state (North Carolina)

Insight 97% was performed in North Carolina. See more on the Contracts tab