Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Techtera, LLCReport or remove this logo

Techtera, LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary SV25RH3HFWK6· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 9K7M8· ELLICOTT CITY, MD· Active registration until Sep 27, 2027· www.techtera.llc (opens in a new tab)

Overview

Buyers and offices that award Techtera prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyBureau of Reclamation$35.4KGREAT PLAINS REGIONAL OFFICE(140R60)$35.4K · Bureau of Reclamation officeTechtera, LLC$35.4K
Awards toSubcontracts toCircle area = dollars

Insight GREAT PLAINS REGIONAL OFFICE (140R60) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2026

$35.4K

Includes FY2026 so far: $35.4K, still being reported

About

From the company's SBA profile, updated Sep 2026

TechTera, LLC is an IT consulting and solutions provider with extensive experience in working with Fortune 500 companies and federal agencies. Our services include software development, cloud migration, analytics, and BI tools. We specialize in federal domain analytics, data strategy, and management initiatives. Our solutions support decision makers to achieve their mission objectives. We provide data integration services such as architecture, MDM, quality, security, warehousing, and ETL. Our expertise includes emerging technologies such as Cloud, AI, Cyber Security, RPA, Mobile Apps, and Agile. Our innovative technology implementations are highly scalable, efficient, and usable.

Prime contract obligations by fiscal year, US$, FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY26$35.4K so far

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. South Dakota$35.4K · 100%
Circle area = dollarsOutlined: head office state (Maryland)

Insight 100% was performed in South Dakota. See more on the Contracts tab