Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Thazen LLCReport or remove this logo

Thazen LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary PT4KKZTHVNK8· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 9HCR8· EUSTIS, FL· Active registration until Jul 31, 2027· www.thazen.com (opens in a new tab)

Overview

Buyers and offices that award Thazen prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyMissile Defense Agency$500MISSILE DEFENSE AGENCY (MDA)(HQ0859)$500 · Missile Defense Agency officeThazen LLC$500
Awards toSubcontracts toCircle area = dollars

Insight MISSILE DEFENSE AGENCY (MDA) (HQ0859) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2026

$500

Includes FY2026 so far: $500, still being reported

Subcontracts it received

$231K

from 1 prime

About

From the company's SBA profile, updated Aug 2026

Founded in 2017, Thazen is a U.S based small business with a team of technologists, engineers and domain experts who provide modern technology consulting, software engineering and cloud platform solutions. We are a capability enhancer that helps your team achieve your mission goals, no matter how complex. We empower government and commercial enterprises to become more effective, innovative, and help organizations achieve their objectives. We are your team of modern technologists and domain experts who provide innovative, secure, and agile software and cloud solutions that transform and modernize software systems for enhanced national security or performance.

Prime contract obligations by fiscal year, US$, FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY26$500 so far

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Alabama$500 · 100%
Circle area = dollarsOutlined: head office state (Florida)

Insight 100% was performed in Alabama. See more on the Contracts tab