Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

The Perkins Group, Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary STXWLLDDB1G5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 3JBK5· ATLANTA, GA· Active registration until Feb 15, 2027

Overview

Buyers and offices that award The Perkins Group prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyUnder Secretary for Farmand Foreign AgriculturalServices$31.3KFPAC BUS CNTR-ACQ DIV-CENTRAL SEC(12FPC1)$31.3K · Under Secretary for Farm and…The Perkins Group, Inc.$31.3K
Awards toSubcontracts toCircle area = dollars

Insight FPAC BUS CNTR-ACQ DIV-CENTRAL SEC (12FPC1) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2024–FY2026

$31.3K

Includes FY2026 so far: $16.3K, still being reported

About

From the company's SBA profile, updated Feb 2026

The Perkins Group, Inc. is a 29-year-old firm that provides human resources, management consulting, and risk management services to the public, private, and nonprofit sectors on an international basis. The Perkins Group, Inc. has been certified as a female, minority-owned business. The firm’s services specialize in strategic planning, training, recruitment consulting, risk financing options, human resource management, loss control, governance and compliance, and organizational review. TPG has the plans and tools to support the successful execution of strategic objectives, while being intentional about maximizing its potential to be catalytic and impactful for its clients. Facilitation, strategic planning, and community and civic engagement are all part of the management and organizational review process.

Prime contract obligations by fiscal year, US$, FY2024–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY24$15KFY26$16.3K so far

Insight Largest year: $15K in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Georgia$31.3K · 100%
Circle area = dollarsOutlined: head office state (Georgia)

Insight 100% was performed in Georgia. See more on the Contracts tab