Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Theriva Biologics, Inc. federal contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary UGJCK56BHQU7· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 7MG59· Rockville, MD· Active registration until May 8, 2027· www.therivabiologics.com (opens in a new tab)

Overview

Buyers and offices that award Theriva Biologics prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyCenters for DiseaseControl and Prevention$521KCDC OFFICE OF ACQUISITION SERVICES(75D301)$521K · Centers for Disease Control and…Theriva Biologics, Inc.$521K
Awards toTheriva Biologics, Inc.ConnectedCircle area = dollars

Insight CDC OFFICE OF ACQUISITION SERVICES (75D301) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2016–FY2026

$521K

No prime awards in FY2026 so far; last obligations in FY2023

About

From the company's SBA profile, updated May 2026

Synthetic Biologics, Inc. (NYSE American: SYN) is a late-stage clinical company developing therapeutics that preserve the microbiome to protect and restore the health of patients. The Company's lead candidates poised for Phase 3 development are: (1) SYN-004 (ribaxamase) which is designed to protect the gut microbiome from the effects of certain commonly used intravenous (IV) beta-lactam antibiotics for the prevention of C. difficile infection (CDI), overgrowth of pathogenic organisms and the emergence of antimicrobial resistance (AMR), and (2) SYN-010 which is intended to reduce the impact of methane producing organisms in the gut microbiome to treat an underlying cause of irritable bowel syndrome with constipation (IBS-C). The Company’s preclinical pursuits include an oral formulation of the enzyme intestinal alkaline phosphatase (IAP) to treat both local GI and systemic diseases

Prime contract obligations by fiscal year, US$, FY2016–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY16$521KFY17FY23$0

Insight Largest year: $521K in FY2016; since FY2021, $0 in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$521K since award = $0 in FY2021–FY2026 + $521K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Georgia$521K · 100%
Circle area = dollarsOutlined: head office state (Maryland)

Insight 100% was performed in Georgia. See more on the Contracts tab