Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Trinco Technologies LLCReport or remove this logo

Trinco Technologies LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary SCCAK1YLUDH3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 3X1Z8· MADISON, WI· Active registration until Dec 5, 2026· www.trinco.us (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyBureau of the FiscalService$234KARC DIV PROC SVCS - TIGTA (203411)$234K · Bureau of the Fiscal Service off…Trinco Technologies LLC$234K
Awards toSubcontracts toCircle area = dollars

Insight ARC DIV PROC SVCS - TIGTA (203411) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2008–FY2026

$574K

About

From the company's SBA profile, updated Dec 2025

Project office and project management, web-based application development, network and workstation services, application development, business analysis. Domain expertise includes federal and state health and human services, corrections and trasportation.

Prime contract obligations by fiscal year, US$, FY2008–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY08FY11$258KFY16FY17FY18FY19FY20FY21FY23−$13.9K

Insight Largest year: $258K in FY2011; since FY2021, $84.3K in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$234K since award = $70.4K in FY2021–FY2026 + $164K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
Circle area = dollarsOutlined: head office state (Wisconsin)

Insight 100% was performed in District of Columbia. See more on the Contracts tab