Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Trutta Environmental Solutions LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary KSEQEJ7JN3M8· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 7UFG4· HENDERSONVILLE, TN· Active registration until Jul 24, 2027· truttasolutions.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNational Park Service$163KSER EAST MABO(51000) (140P51)$163K · National Park Service officeTrutta Environmental Solutions LLC$163K
Awards toSubcontracts toCircle area = dollars

Insight SER EAST MABO(51000) (140P51) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2018–FY2026

$163K

About

From the company's SBA profile, updated Aug 2026

Trutta Environmental Solutions, LLC is an SBA-certified 8(a) Woman-Owned Small Business (WOSB) providing water resources, aquatic science, and environmental consulting services to federal, state, and local agencies. Core capabilities include stream and river surveys, stream assessments, stream restoration, dam removal support, habitat and substrate assessments, submerged aquatic vegetation (SAV) surveys, water quality and quantity monitoring, bathymetry, cross-sections, river transects, watershed assessments, illicit discharge investigations, FERC support, Abandoned Mine Lands (AML) assessments, GPS/GIS mapping, and technical reporting. Our proprietary High Definition Stream Survey (HDSS) integrates GPS, video, and environmental data to deliver accurate, efficient, and comprehensive datasets that improve decision-making, reduce field costs, and support successful environmental and infrastructure projects.

Prime contract obligations by fiscal year, US$, FY2018–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY18$104KFY19FY20FY21FY22FY23$0

Insight Largest year: $104K in FY2018; since FY2021, $0 in FY2022. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$163K since award = −$16 in FY2021–FY2026 + $164K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Georgia$163K · 100%
Circle area = dollarsOutlined: head office state (Tennessee)

Insight 100% was performed in Georgia. See more on the Contracts tab