Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Visure Solutions Inc.Report or remove this logo

Visure Solutions Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary KP9VX2KXTAA3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 95SX0· ATLANTA, GA· Active registration until Apr 13, 2027· visuresolutions.com (opens in a new tab)

Overview

Buyers and offices that award Visure Solutions prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyFederal AviationAdministration$52.3K6973GH FRANCHISE ACQUISITION SVCS$52.3K · Federal Aviation Administration…Visure Solutions Inc.$52.3K
Awards toSubcontracts toCircle area = dollars

Insight 6973GH FRANCHISE ACQUISITION SVCS is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2025–FY2026

$52.3K

About

From the company's SBA profile, updated Apr 2026

Visure Solutions, Inc. offers specialized, innovative, and user-friendly solutions to implement efficient requirements definition and management processes, aimed at guaranteeing the highest quality in the development of our clients’ products, systems and services. Visure Requirements ALM Platform is an easy to use and comprehensive Requirements Management software solution. Visure’s core product strategy is to offer a collaborative and centralized Requirements ALM platform for distributed stakeholders, capable of supporting different development lifecycle processes (Agile, V model, Waterfall, etc). Visure brings a mix of innovative technology and market expertise to allow our customers to leverage deep domain expertise in Systems Engineering practices, Project Development and Processes.

Prime contract obligations by fiscal year, US$, FY2025–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY25$52.3K

Insight Largest year: $52.3K in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Georgia$52.3K · 100%
Circle area = dollarsOutlined: head office state (Georgia)

Insight 100% was performed in Georgia. See more on the Contracts tab