Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Weelevateit LLCReport or remove this logo

Weelevateit LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary KWEBG1JH9BK7· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 9VJ53· FAIRFAX, VA· Active registration until Mar 4, 2027· weElevateIT.com (opens in a new tab)

Overview

Buyers and offices that award Weelevateit prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$1.27MFA7146 SAF OC PK$1.27M · Air Force officeWeelevateit LLC$1.27M
Awards toSubcontracts toCircle area = dollars

Insight FA7146 SAF OC PK is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2025–FY2026

$1.27M

Includes FY2026 so far: $300K, still being reported

About

From the company's SBA profile, updated Mar 2026

weElevateIT is a forward-thinking technology services provider specializing in Advisory, AI, automation, and data services. As a proud UiPath Authorized Partner, weElevateIT offers innovative and game-changing capabilities across the Department of Defense (DoD) and Military Services landscape. Our expertise includes process mining, Generative AI, and Intelligent Document Processing, enabling us to deliver scalable solutions that drive digital transformation and operational excellence. Led by Founder and CEO Brian Jacobs, a pioneer in automation and robotic process automation (RPA) within the public sector, weElevateIT is committed to providing best-in-class services and expertise to help our clients achieve their mission goals. Our deep domain knowledge and experience, combined with UiPath's powerful platform, allow us to automate complex and high-value processes, ensuring our clients stay ahead in a rapidly evolving technological landscape.

Prime contract obligations by fiscal year, US$, FY2025–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY25$973KFY26$300K so far

Insight Largest year: $973K in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$1.27M · 100%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 100% was performed in Virginia. See more on the Contracts tab