Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Wisconsin Ordnance Works Ltd. federal contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary GLRMM71HG9J5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8A675· Oshkosh, WI· Active registration until Apr 26, 2027· www.wisord.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyDefense Logistics Agency$17.8MDLA LAND AND MARITIME (SPE7L3)$6.15M · Defense Logistics Agency officeDLA LAND AND MARITIME (SPE7L1)$4.37M · Defense Logistics Agency officeDLA LAND AND MARITIME (SPE7LX)$4.27M · Defense Logistics Agency office7 more offices$3.06MWisconsin Ordnance Works Ltd.$17.8M
Awards toWisconsin Ordnance Works Ltd.ConnectedGroupedCircle area = dollars

Insight DLA LAND AND MARITIME (SPE7L3) is its largest buyer. See more on the Buyers tab

10 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2001–FY2026

$39.1M

Includes FY2026 so far: $4.88M, still being reported

Subcontracts it received

$81.5M

from 4 primes

About

From the company's SBA profile, updated Sep 2026

Wisconsin Ordnance Works (WOW) is a premier manufacturer of mission-critical powertrain, drivetrain, structural, mounting, and suspension components supporting ground, air, and maritime defense platforms. We supply major defense OEMs and the U.S. Department of Defense with the precision-engineered parts required to field next-generation systems — and to sustain the legacy platforms that continue to protect our nation across every domain. From armored vehicles to aircraft, and from undersea systems to emerging modernization programs, WOW is a trusted partner in production, overhaul, and lifecycle support. Our components help assemble, rebuild, and maintain the equipment that keeps America’s warfighters ready wherever the mission takes them. Wisconsin Ordnance Works — put the WOW factor in your supply chain.

Prime contract obligations by fiscal year, US$, FY2001–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY01FY03FY05FY07FY09FY11FY13FY15FY17FY19FY21FY23$6.62MFY26FY26 so far: $4.88M

Insight Largest year: $6.62M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Wisconsin$16M · 90%
  2. Michigan$1.82M · 10%
Circle area = dollarsOutlined: head office state (Wisconsin)

Insight 90% was performed in Wisconsin. See more on the Contracts tab