Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Xcelligen Inc.Report or remove this logo

Xcelligen Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary MLG3RBFBA8J3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8MCL8· HERNDON, VA· Active registration until Jul 17, 2027· www.xcelligen.com (opens in a new tab)

Overview

Buyers and offices that award Xcelligen prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyU.S. Census Bureau$920KMissile Defense Agency$500Navy$500DEPT OF COMMERCE CENSUS (1333LB)$920K · U.S. Census Bureau officeMISSILE DEFENSE AGENCY (MDA)(HQ0859)$500 · Missile Defense Agency officeNSWC DAHLGREN (N00178)$500 · Navy officeXcelligen Inc.$921K
Awards toSubcontracts toCircle area = dollars

Insight DEPT OF COMMERCE CENSUS (1333LB) is its largest buyer. See more on the Buyers tab

3 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2024–FY2026

$921K

Includes FY2026 so far: $500, still being reported

About

From the company's SBA profile, updated Aug 2026

Established in 2014, Xcelligen is an Advanced Cloud Engineering and IT Solutions Provider. As an IT Solutions Provider, we specialize in Agile DevSecOps, Agile Software Development and Software Engineering Services, Application Analysis, Application Migration, ATO requirements for DoD networks, Cloud Migration – Infrastructure and Apps Legacy Systems, Cloud Security, Cybersecurity – Threat Assessment & Vulnerability Assessment, Data Analytics, Database Administration, Enterprise Architecture, Machine Learning Operations (MLOps), Modernization, Network Security, Program & Project Management, Systems Engineering, Systems Integration and Web Services. Natural Language Processing (NLP), Artificial Intelligence (AI), Machine Learning (ML), Deep Learning, Text Generation, Text Classification, Sentiment Analysis, Sequence-to-Sequence Models.

Prime contract obligations by fiscal year, US$, FY2024–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY24$920KFY25FY26$500 so far

Insight Largest year: $920K in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Maryland$920K · 99%
  2. Alabama$500 · 0.1%
  3. Virginia$500 · 0.1%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 99% was performed in Maryland. See more on the Contracts tab