Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Zcore Business Solutions, Inc.Report or remove this logo

Zcore Business Solutions, Inc. federal contracts

Correct this listing

Doing business as ZCORE

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary SG5WEHG9ETA1· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 1YTD3· Round Rock, TX· Active registration until Jul 7, 2027· www.laukoa.com (opens in a new tab)

Part of Hawaiian Native Corporation (opens another page) (parent company) · One of 29 registrations

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyDefense Health Agency$24MArmy$11.4MVeterans Affairs$107KARMY MED RES ACQ ACTIVITY (HT9425)$21.8M · Defense Health Agency officeW4PZ USA MED RSCH ACQUIS ACT (W81…$10.2M · Army officeDEFENSE HEALTH AGENCY (HT0011)$1.53M · Defense Health Agency office3 more offices$1.91MZcore Business Solutions, Inc.$35.5M
Awards toZcore Business Solutions, Inc.ConnectedGroupedCircle area = dollars

Insight ARMY MED RES ACQ ACTIVITY (HT9425) is its largest buyer. See more on the Buyers tab

6 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2004–FY2026

$52.5M

No prime awards in FY2026 so far

About

From the company's SBA profile, updated Jul 2026

zCore Business Solutions, Inc. (zCore) is a minority-owned, Small Business Administration (SBA) certified Small Disadvantaged Business (SDB), and Economically Disadvantaged Woman-Owned Small Business (EDWOSB). We specialize in Strategic, Operational, Technology, Research, and Support consulting services with a focus on customer centric mission support to commercial, federal and state & local communities. Our core competence is team-based solutions: developing synergy between our clients, partners, the domain experts, and ourselves, adding value to all parties and driving solutions to meet mission objectives.

Prime contract obligations by fiscal year, US$, FY2004–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY04FY06FY08FY10FY12FY14FY16FY18FY20FY22$5.58MFY25FY25: $128K

Insight Largest year: $5.58M in FY2022. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$35.5M since award = $18.7M in FY2021–FY2026 + $16.8M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Texas$34.7M · 98%
  2. California$655K · 1.8%
  3. District of Columbia$107K · 0.3%
  4. Virginia$2,500 · 0.0%
Circle area = dollarsOutlined: head office state (Texas)

Insight 98% was performed in Texas. See more on the Contracts tab