Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Zibiz Corporation federal contracts

Correct this listing

Doing business as SANSPOT

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary UDATF1HQYW11· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 3C1S4· Hauppauge, NY· Active registration until May 15, 2027· www.zibiz.com (opens in a new tab)

Overview

Buyers and offices that award Zibiz prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyBureau of the FiscalService$2.17MNational Oceanic andAtmospheric Administrati…$792KDepartmental Offices$158K4 more$50.8KFISCAL SERVICE (2033H6)$2.17M · Bureau of the Fiscal Service of…DEPT OF COMMERCE NOAA (1305M3)$792K · National Oceanic and Atmospheri…IBC ACQ SVCS DIRECTORATE (00004) (14…$158K · Departmental Offices office7 more offices$50.8KZibiz Corporation$3.17M
Awards toZibiz CorporationConnectedGroupedCircle area = dollars

Insight FISCAL SERVICE (2033H6) is its largest buyer. See more on the Buyers tab

10 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2005–FY2026

$128M

Includes FY2026 so far: $18.2K, still being reported

About

From the company's SBA profile, updated May 2026

Design and integration of data storage solutions including hardware/software procurement, SAN, NAS, virtualization, backups, archiving & disaster recovery etc. EMC, Sun Microsystems, VMWare VAC, HP, Data Domain, Riverbed, Symantec, Quantum & 3PAR Partner

Prime contract obligations by fiscal year, US$, FY2005–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY05FY08FY10FY12$22.3MFY14FY16FY18FY20FY22FY24FY26$18.2K so far

Insight Largest year: $22.3M in FY2012; since FY2021, $669K in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$3.17M since award = $711K in FY2021–FY2026 + $2.46M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. New York$2.23M · 70%
  2. West Virginia$434K · 14%
  3. California$238K · 7.5%
  4. Colorado$158K · 5.0%
  5. Washington$107K · 3.4%

2 smaller, $2,907 together.

Circle area = dollarsOutlined: head office state (New York)

Insight 70% was performed in New York. See more on the Contracts tab