Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

A1m Solutions, Inc. Federal Contracts

Correct this listing

Doing business as A1M SOLUTIONS INC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary ZPGUVM99QXX7· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 81NC7· CHICO, CA· Active registration until Sep 16, 2027· www.A1MSolutions.com (opens in a new tab)

Overview

Buyers and offices that award A1m Solutions prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyCenters for Medicare andMedicaid Services$47.1MOffice of the AssistantSecretary forAdministration$5MDepartmental Offices$308KOFC OF ACQUISITION AND GRANTS MGMT(75FCMC)$47.1M · Centers for Medicare and Medi…PROGRAM SUPPORT CENTER ACQ MGMTSVC (75P001)$5M · Office of the Assistant Secretary…TREASURY OPERATIONS (2032H3)$308K · Departmental Offices officeA1m Solutions, Inc.$52.4M
Awards toSubcontracts toCircle area = dollars

Insight OFC OF ACQUISITION AND GRANTS MGMT (75FCMC) is its largest buyer. See more on the Buyers tab

3 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2021–FY2026

$52.4M

Includes FY2026 so far: $18.7M, still being reported

About

From the company's SBA profile, updated Sep 2026

Woman owned small business specializing in healthcare IT in the Medicare and Medicaid sectors. Capabilities include HCD, UX/CX design, organizational change management, data analytics and visualization, agile development, product management, policy, project management, consulting, and usability testing. Domain expertise in Medicare Medicaid and the Centers for Medicare and Medicaid Services (CMS).

Prime contract obligations by fiscal year, US$, FY2021–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY21FY22FY23FY24$12.3MFY25FY26$18.7M so far

Insight Largest year: $12.3M in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. California$31.9M · 61%
  2. Maryland$20.6M · 39%
Circle area = dollarsOutlined: head office state (California)

Insight 61% was performed in California. See more on the Contracts tab