Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Ad & Resources LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary D48HBAGAUJX1· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 07QA6· GAITHERSBURG, MD· Active registration until Aug 26, 2027· www.strategicresults.com (opens in a new tab)

Overview

Buyers and offices that award Ad & Resources prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyU.S. Immigration andCustoms Enforcement$3.64MImmediate Office of theSecretary ofTransportation$2.77MNational Institutes ofHealth$1.69M6 more$1.14MMISSION SUPPORT WASHINGTON(70CMSW)$3.64M · U.S. Immigration and Customs…693JK4 OST$2.77M · Immediate Office of the Secret…FA2860 316 CONS PK$547K · Air Force office15 more offices$2.28MAd & Resources LLC$9.23M
Awards toSubcontracts toCircle area = dollars

Insight MISSION SUPPORT WASHINGTON (70CMSW) is its largest buyer. See more on the Buyers tab

18 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2001–FY2026

$22.9M

Includes FY2026 so far: $723K, still being reported

Subcontracts it received

$6.55M

from 3 primes

About

From the company's SBA profile, updated Sep 2026

Strategic Results delivers integrated services and solutions that exceed customer expectations through extensive domain knowledge, effective processes, emphasis on innovation, and our talented, experienced team. Our services include: acquisition, training, project and real estate portfolio management. Strategic Results has a proven track record of successfully blending high quality services with lowest cost price models.

Prime contract obligations by fiscal year, US$, FY2001–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY01FY03FY05FY07FY09FY11FY13FY15FY17FY19FY21FY23$3.9MFY26FY26 so far: $723K

Insight Largest year: $3.9M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$9.23M since award = $6.24M in FY2021–FY2026 + $3M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. District of Columbia$3.66M · 40%
  2. Oklahoma$2.77M · 30%
  3. Maryland$2.51M · 27%
  4. California$109K · 1.2%
  5. Virginia$97.2K · 1.1%

1 smaller, $96.1K together.

Circle area = dollarsOutlined: head office state (Maryland)

Insight 40% was performed in District of Columbia. See more on the Contracts tab