Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Analytical Services, Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary K5Y3MDHD2MB5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 0Z229· HUNTSVILLE, AL· Active registration until Jun 24, 2027· www.asrcfederal.com/companies (opens in a new tab)

Part of Arctic Slope Regional Corporation (opens another page) (parent company) · One of 88 registrations

Overview

Buyers, Analytical Services and its subcontractors, US$, contracts active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026; subcontractors: reported value since award

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companySubcontractorsMissile Defense Agency$296MArmy$69.3MDefense InformationSystems Agency$32.5M2 more$23.6MMISSILE DEFENSEAGENCY (MDA) (HQ0858)$165M · Missile Defense…MISSILE DEFENSEAGENCY (MDA) (HQ0857)$73.8M · Missile Defense…W6QK ACC-RSA (W31P4Q)$64.9M · Army office7 more offices$118MAnalytical Services, Inc.$422MPifinity, Inc.$18.4MLogos Enterprises, Inc.$10.5MMulti-domain Inc.$4.04MWorld Wide Technology LLC$3.94MTrilogy Leasing Co. LLC$3.63MDigital Fusion Solutions, Inc.$2.91M61 more$23.7M
Awards toSubcontracts toCircle area = dollars

Insight Two subcontractorsSubcontractor (sub): a company hired by the prime to do part of a federal contract. It works for the prime, not the government. Glossary received 43% of what it reported subcontracting. See more on the Teaming tab

10 buying officesAll 67 subcontractors

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2001–FY2026

$853M

Includes FY2026 so far: −$40.1K, still being reported

Subcontracts it reported, on contracts active FY2021–FY2026

$67.2M

67 subcontractors

Subcontracts it received

$2.01M

from 3 primes

About

From the company's SBA profile, updated Jun 2026

ASI is a nationally recognized small business providing management and technical services. Capabilities encompass four areas: IT, systems engineering & program management, organizational & professional development and engineering & scientific analysis.

Prime contract obligations by fiscal year, US$, FY2001–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY01FY03FY05FY07$84.6MFY09FY11FY13FY15FY17FY19FY21FY23FY26FY26 so far: −$40.1K

Insight Largest year: $84.6M in FY2008; since FY2021, $33.2M in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$422M since award = $134M in FY2021–FY2026 + $288M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Alabama$420M · 99%
  2. Georgia$1.53M · 0.4%
Circle area = dollarsOutlined: head office state (Alabama)

Insight 99% was performed in Alabama. See more on the Contracts tab