Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Multi-domain Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary JFKEK4G3Z166· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 963D0· COLUMBIA, TN· Active registration until Nov 5, 2026· MultiDomain.us (opens in a new tab)

Overview

Buyers and offices that award Multi-domain prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$1,000Missile Defense Agency$500FA8656 AFLCMC EBX$1,000 · Air Force officeMISSILE DEFENSE AGENCY (MDA)(HQ0859)$500 · Missile Defense Agency officeMulti-domain Inc.$1,500
Awards toSubcontracts toCircle area = dollars

Insight FA8656 AFLCMC EBX is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2025–FY2026

$1,500

Includes FY2026 so far: $500, still being reported

Subcontracts it received

$5.91M

from 3 primes

Prime contract obligations by fiscal year, US$, FY2025–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY25$1,000FY26$500 so far

Insight Largest year: $1,000 in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Florida$1,000 · 67%
  2. Alabama$500 · 33%
Circle area = dollarsOutlined: head office state (Tennessee)

Insight 67% was performed in Florida. See more on the Contracts tab