Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Bering Sea Environmental LLCReport or remove this logo

Bering Sea Environmental LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary J4NXZFGSEBF4· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 3U7U3· ANCHORAGE, AK· Active registration until Jul 27, 2027· www.bsenv.com (opens in a new tab)

Part of Tanadgusix Corporation (opens another page) (parent company) · One of 18 registrations

Overview

Buyers, this company and its subcontractors, US$, contracts active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026; subcontractors: reported value since award

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companySubcontractorsAir Force$92.3MArmy$26.9MNavy$936KFA4890 HQ ACC AMIC$66.3M · Air Force officeW39L USA NG READINESSCENTER (W9133L)$26.2M · Army officeFA5215 766 ESS PKP$21.7M · Air Force office3 more offices$5.85MBering Sea EnvironmentalLLC$120MBset, LLC$11MBering Sea Eccotech, LLC$3.69MDiverse Technology Korps, Inc.$1.91MZeido Technologies, LLC$722KAdvanced Simulation Technology, Inc.$500KHDR Environmental, Operations AndConstruction, Inc.$205K2 more$181K
Awards toSubcontracts toCircle area = dollars

Insight Two subcontractorsSubcontractor (sub): a company hired by the prime to do part of a federal contract. It works for the prime, not the government. Glossary received 81% of what it reported subcontracting. See more on the Teaming tab

6 buying officesAll 8 subcontractors

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2007–FY2026

$275M

Includes FY2026 so far: $675K, still being reported

Subcontracts it reported, on contracts active FY2021–FY2026

$18.3M

8 subcontractors

Subcontracts it received

$25.1M

from 5 primes

About

From the company's SBA profile, updated Jul 2026

Project management, field specialty welding services, construction and renovation of facilities, clearance of ranges, range residue demilitarization, segregation of Low Level Radioactive Waste (LLRW).

Prime contract obligations by fiscal year, US$, FY2007–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY07FY09FY11FY13FY15$48.3MFY17FY19FY21FY23FY26$675K so far

Insight Largest year: $48.3M in FY2015; since FY2021, $15.2M in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$120M since award = $37.4M in FY2021–FY2026 + $82.7M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Idaho$66.3M · 55%
  2. Maryland$26.2M · 22%
  3. Hawaii$9.84M · 8.2%
  4. Alaska$4.25M · 3.5%
  5. Florida$936K · 0.8%

1 smaller, $669K together.

No US state recorded: $11.9M · 9.9%

Circle area = dollarsOutlined: head office state (Alaska)

Insight 61% was performed in Idaho. See more on the Contracts tab