Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
BSX, LLCReport or remove this logo

BSX, LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary JKJTA8M1WDF7· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6TLM9· ANCHORAGE, AK· Active registration until Jun 17, 2027· www.beringseagroup.com (opens in a new tab)

Part of Tanadgusix Corporation (opens another page) (parent company) · One of 18 registrations

Overview

Buyers, BSX and its subcontractors, US$, contracts active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026; subcontractors: reported value since award

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companySubcontractorsArmy$10.4MNavy$3.92MAir Force$460KNAVFACSYSCOMATLANTIC (N62470)$3.92M · Navy officeW075 ENDISTSACRAMENTO (W91238)$3.9M · Army officeW6QK ACC-RI (W519TC)$3.82M · Army office3 more offices$3.11MBSX, LLC$14.7MParsons Government Services Inc.$1.16MM.p. Environmental Services, Inc.$685KDel Mar Environmental & ConstructionServices Inc.$527KBering Sea Eccotech, LLC$231KWra, Inc.$158KGeneral Safety Services Corporation$28.9K
Awards toSubcontracts toCircle area = dollars

Insight Two subcontractorsSubcontractor (sub): a company hired by the prime to do part of a federal contract. It works for the prime, not the government. Glossary received 66% of what it reported subcontracting. See more on the Teaming tab

6 buying officesAll 6 subcontractors

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2017–FY2026

$17.5M

Subcontracts it reported, on contracts active FY2021–FY2026

$2.79M

6 subcontractors

Subcontracts it received

$2.99M

from 2 primes

About

From the company's SBA profile, updated Jun 2026

Range residue recycling and range clearance to include operational ranges. Environmental assessments, unexploded ordnance identification and disposal.

Prime contract obligations by fiscal year, US$, FY2017–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY17FY18FY19FY20FY21$3.68MFY22FY23FY24FY25−$59.4K

Insight Largest year: $3.68M in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$14.7M since award = $7.95M in FY2021–FY2026 + $6.8M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. California$8.14M · 55%
  2. North Carolina$2.63M · 18%
  3. Virginia$1.01M · 6.8%
  4. New Jersey$859K · 5.8%
  5. Alaska$700K · 4.7%

3 smaller, $1.4M together.

Circle area = dollarsOutlined: head office state (Alaska)

Insight 55% was performed in California. See more on the Contracts tab