Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Blueprint Creative Group, LLCReport or remove this logo

Blueprint Creative Group, LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary DLWKJXG3TZ65· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 85K76· MIAMI, FL· Active registration until Oct 20, 2026· www.BlueprintCreativeGroup.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyDefense Health Agency$1.61MArmy$488KUnited States Trade andDevelopment Agency$237K1 more$57.3KARMY MED RES ACQ ACTIVITY (HT9425)$1.61M · Defense Health Agency officeW7MY USPFO ACTIVITY CO ARNG(W912LC)$487K · Army officeUS TRADE AND DEVELOPMENT AGENCY(1131PL)$237K · United States Trade and Develop…3 more offices$58KBlueprint Creative Group, LLC$2.39M
Awards toSubcontracts toCircle area = dollars

Insight ARMY MED RES ACQ ACTIVITY (HT9425) is its largest buyer. See more on the Buyers tab

6 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2023–FY2026

$2.39M

Subcontracts it received

$337K

from 1 prime

About

From the company's SBA profile, updated Oct 2025

Blueprint Creative Group is an 8(a) and WOSB certified program management and strategic communications firm with domain expertise in health and science solutions supporting the U.S. Army Medical Research and Development Command (USAMRDC), University of Utah Health, National Institute on Drug Abuse (NIDA), and other health agencies. We also support transportation agencies with public safety programs; Defense agencies with visual information, recruiting and retention; international development agencies with technical assistance and trade development; and program offices with training and development, public affairs, congressional support, business operations support, and turnkey meeting and event logistics. For public health agencies, Blueprint specializes in health literacy and cultural competency for diverse communities, behavioral science, medical research communications, and stakeholder engagement.

Prime contract obligations by fiscal year, US$, FY2023–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY23$1.13MFY24FY25$226K

Insight Largest year: $1.13M in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Maryland$1.61M · 67%
  2. Florida$568K · 24%
  3. Colorado$156K · 6.5%
  4. District of Columbia$57.3K · 2.4%
  5. Georgia$712 · 0.0%
Circle area = dollarsOutlined: head office state (Florida)

Insight 67% was performed in Maryland. See more on the Contracts tab