Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Coretech Consulting Inc. Federal Contracts

Correct this listing

Doing business as CORETECH CONSULTING INC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary CK6NXACREFF6· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6Z8H4· GREAT FALLS, VA· Active registration until May 6, 2027· www.coretechfederal.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyU.S. Cyber Command$2.25MDefense EducationActivity$2.02MMissile Defense Agency$5001 more$500CYBER PROCUREMENT OFFICE (HB0001)$2.25M · U.S. Cyber Command officeDOD EDUCATION ACTIVITY (HE1254)$2.02M · Defense Education Activity off…MISSILE DEFENSE AGENCY (MDA)(HQ0859)$500 · Missile Defense Agency office1 more offices$500Coretech Consulting Inc.$4.27M
Awards toSubcontracts toCircle area = dollars

Insight CYBER PROCUREMENT OFFICE (HB0001) is its largest buyer. See more on the Buyers tab

4 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2025–FY2026

$4.27M

Includes FY2026 so far: $2.02M, still being reported

Subcontracts it received

$5.31M

from 1 prime

About

From the company's SBA profile, updated May 2026

Founded in 2013, CoreTech Consulting Inc. (CoreTech) stands as a beacon of excellence with a steadfast commitment to advancing Federal Agencies’ missions by delivering accurate, reliable, and standardized financial information that supports auditable outcomes. An SBA 8(a), EDWOSB, and SWaM-certified small business, Top Secret FCL, CoreTech serves as a Trusted Partner, Advisor, and Subject Matter Expert (SME) spearheading Financial Management Systems–focused IT modernization and operational support initiatives across the Federal landscape. CoreTech brings deep domain expertise in DAI ERP, ADVANA, PPBE/EPM Cloud, DFAS financial operations, and ITSM service delivery, enabling agencies to modernize legacy environments, improve data integrity, strengthen governance and compliance, and sustain audit readiness. Core Competencies: ERP, Operational Management; Data Analytics & Artificial Intelligence; Core Technologies; Enterprise Applications

Prime contract obligations by fiscal year, US$, FY2025–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY25$2.25MFY26$2.02M so far

Insight Largest year: $2.25M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Maryland$2.25M · 53%
  2. Virginia$2.02M · 47%
  3. Alabama$500 · 0.0%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 53% was performed in Maryland. See more on the Contracts tab