Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Data Computer Corporation Of AmericaReport or remove this logo

Data Computer Corporation Of America federal contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary NVD5YJZ4HCL4· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 3Y586· Ellicott City, MD· Active registration until Jul 16, 2027· www.dcca.com (opens in a new tab)

Overview

Buyers, this company and its subcontractors, US$, contracts active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026; subcontractors: reported value since award

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companySubcontractorsCenters for Medicare andMedicaid Services$445MAir Force$118MDefense Health Agency$49.6M2 more$6.56MOFC OF ACQUISITION AND…$441M · Centers for Med…FA4610 30 CONS PK$118M · Air Force officeDEFENSE HEALTHAGENCY (HT9402)$49.6M · Defense Health…3 more offices$10.2MData ComputerCorporation Of America$620MCornet Technology, Inc.$221KEnterprise Integration, Inc.$220KStonewall Cable, Inc.$68KM2 Technology, Inc.$54.8KNetacquire Corp.$40.9K
Awards toSubcontracts toData Computer Corporation Of AmericaConnectedGroupedCircle area = dollars

Insight Two subcontractorsSubcontractor (sub): a company hired by the prime to do part of a federal contract. It works for the prime, not the government. Glossary received 73% of what it reported subcontracting. See more on the Teaming tab

6 buying officesAll 5 subcontractors

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2001–FY2026

$771M

Includes FY2026 so far: $48.9M, still being reported

Subcontracts it reported, on contracts active FY2021–FY2026

$605K

5 subcontractors

Subcontracts it received

$4.39M

from 6 primes

About

From the company's SBA profile, updated Aug 2026

DCCA, a veteran-owned IT systems development and engineering company, leverages deep domain expertise to solve large, complex issues. Our cleared and certified professional serve as subject matter experts, incorporating advanced technologies with open source solutions and agile development processes that drive cost savings and performance efficiencies. We employ continuous process improvement and industry-leading practices supporting defense, intelligence, national security, healthcare and federal civilian agencies.

Prime contract obligations by fiscal year, US$, FY2001–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY01FY03FY05FY07FY09FY11FY13FY15FY17$70.8MFY19FY21FY23FY26FY26 so far: $48.9M

Insight Largest year: $70.8M in FY2017; since FY2021, $60.4M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$620M since award = $267M in FY2021–FY2026 + $353M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Maryland$566M · 91%
  2. Colorado$49.6M · 8.0%
  3. California$3.81M · 0.6%
  4. Alabama$500 · 0.0%
Circle area = dollarsOutlined: head office state (Maryland)

Insight 91% was performed in Maryland. See more on the Contracts tab