Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Index Analytics LLCReport or remove this logo

Index Analytics LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary QYFPCDC4JMC5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6UAF0· WINDSOR MILL, MD· Active registration until May 1, 2027· index-analytics.com (opens in a new tab)

Overview

Buyers, Index Analytics and its subcontractors, US$, contracts active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026; subcontractors: reported value since award

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companySubcontractorsCenters for Medicare andMedicaid Services$465MFood and DrugAdministration$9.07MOffice of the AssistantSecretary forAdministration$7.69M2 more$4.22MOFC OF ACQUISITION ANDGRANTS MGMT (75FCMC)$465M · Centers for Med…FDA OFFICE OF ACQGRANT SVCS (75F401)$9.07M · Food and Drug A…PROGRAM SUPPORTCENTER ACQ MGMT SVC(75P001)$7.69M · Office of the As…2 more offices$4.22MIndex Analytics LLC$486MInternational Business MachinesCorporation$5.69MGeneral Dynamics InformationTechnology, Inc.$2.83MMyers And Stauffer Lc$2.27MAurotech LLC$2.04MMagpie Health Analytics Inc.$1.86MImpaq International, LLC$1.29M11 more$5.08M
Awards toSubcontracts toCircle area = dollars

Insight Two subcontractorsSubcontractor (sub): a company hired by the prime to do part of a federal contract. It works for the prime, not the government. Glossary received 40% of what it reported subcontracting. See more on the Teaming tab

5 buying officesAll 17 subcontractors

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2017–FY2026

$503M

Includes FY2026 so far: $143M, still being reported

Subcontracts it reported, on contracts active FY2021–FY2026

$21.1M

17 subcontractors

Subcontracts it received

$39.9M

from 9 primes

About

From the company's SBA profile, updated May 2026

Index Analytics LLC, based out of Baltimore, MD, is an established 8(a) and HUBZone small disadvantaged business. Since 2012, we have worked exclusively in the federal domain and supported multiple enterprise-wide analytics, data visualization, data strategy and data management initiatives. Our award winning Business Intelligence (BI) and data integration solutions support decision makers and stakeholders in the pursuit of their mission objectives. We perform data strategy and maturity assessments to ensure that the federal agency's data assets are providing the expected ROI and the data initiatives are aligned with the business needs. We provide data integration services including data architecture; Master Data Management (MDM); data quality; security; data warehousing; Extract, Transform and Load (ETL). We develop cutting-edge applications using cloud based Salesforce Customer Relationship Management (CRM) tools like Wave Analytics, Community Builder, and Lightning App Builder.

Prime contract obligations by fiscal year, US$, FY2017–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY17FY18FY19FY20FY21FY22FY23FY24FY25$115MFY26$143M so far

Insight Largest year: $115M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$486M since award = $464M in FY2021–FY2026 + $22M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Maryland$483M · 99%
  2. Georgia$2.91M · 0.6%
Circle area = dollarsOutlined: head office state (Maryland)

Insight 99% was performed in Maryland. See more on the Contracts tab