Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Human Domain Solutions, LLCReport or remove this logo

Human Domain Solutions, LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary K1U6JAFA9H89· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6XRG6· ALEXANDRIA, VA· Active registration until Mar 16, 2027· www.humandomainsolutions.us (opens in a new tab)

Part of Human Domain Solutions, LLC (opens another page) (parent company) · The parent company's own registration, one of 2 · Company group: Human Domain Solutions, LLC (2 registrations)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyArmy$10.7MNavy$2.34MVeterans Affairs$888K5 more$702KNAVSUP FLT LOG CTR NORFOLK (N00189)$2.15M · Navy officeW7M7 USPFO ACTIVITY IN ARNG (W912L9)$1.17M · Army officeW7M4 USPFO ACTIVITY HI ARNG (W912J6)$917K · Army office51 more offices$10.4MHuman Domain Solutions, LLC$14.6M
Awards toSubcontracts toCircle area = dollars

Insight NAVSUP FLT LOG CTR NORFOLK (N00189) is its largest buyer. See more on the Buyers tab

54 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2016–FY2026

$23M

Includes FY2026 so far: $1.67M, still being reported

Subcontracts it received

$6.95M

from 6 primes

About

From the company's SBA profile

Human Domain Solutions provides training, consulting, and staffing support to federal and commercial clients in the core areas of the Human Domain, including Human Intelligence (HUMINT) and counter-intelligence, foreign affairs, security cooperation/security assistance (FMS/IMET), special operations forces, SOF, language/region/culture (LRC), and disaster preparedness/response

Prime contract obligations by fiscal year, US$, FY2016–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY16FY17FY18FY19$4.32MFY20FY21FY22FY23FY24FY25FY26$1.67M so far

Insight Largest year: $4.32M in FY2019; since FY2021, $3.17M in FY2022. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$14.6M since award = $12.9M in FY2021–FY2026 + $1.74M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$2.17M · 15%
  2. Indiana$1.39M · 9.5%
  3. Florida$993K · 6.8%
  4. Maryland$982K · 6.7%
  5. Hawaii$917K · 6.3%

31 smaller, $7.62M together.

No US state recorded: $538K · 3.7%

Circle area = dollarsOutlined: head office state (Virginia)

Insight 15% was performed in Virginia. See more on the Contracts tab