Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Pherson Associates, LLCReport or remove this logo

Pherson Associates, LLC Federal Contracts

Correct this listing

Doing business as PHERSON ASSOCIATES LLC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary FFKBZ86EXD93· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 3HXP9· RESTON, VA· Active registration until Nov 19, 2026· www.pherson.org (opens in a new tab)

Overview

Buyers, Pherson Associates and its subcontractors, US$, contracts active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026; subcontractors: reported value since award

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companySubcontractorsOffice of ProcurementOperations$12.5MTransportation SecurityAdministration$7.9MDefenseCounterintelligence andSecurity Agency$5.78M6 more$2.75MDEPARTMENTALOPERATIONS ACQUISITIONDIVISION II (70RDA2)$7.51M · Office of Procu…CLOSEOUT (70T070)$5.95M · Transportation…DEFENSE CI ANDSECURITY AGENCY(HS0021)$5.78M · Defense Counte…10 more offices$9.71MPherson Associates, LLC$29MGlobal Skills Exchange Corporation$1.2MWatermark Risk ManagementInternational, LLC$736KC2 Technologies, Inc.$434KHuman Domain Solutions, LLC$361KLarson Corporation$304K
Awards toSubcontracts toCircle area = dollars

Insight Two subcontractorsSubcontractor (sub): a company hired by the prime to do part of a federal contract. It works for the prime, not the government. Glossary received 64% of what it reported subcontracting. See more on the Teaming tab

13 buying officesAll 5 subcontractors

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2006–FY2026

$30.6M

Includes FY2026 so far: $4.09M, still being reported

Subcontracts it reported, on contracts active FY2021–FY2026

$3.04M

5 subcontractors

Subcontracts it received

$1.73M

from 2 primes

About

From the company's SBA profile, updated Nov 2025

Pherson's core capabilities include helping organizations understand, adapt and act in a rapidly changing and complex world. We adapt best practices in thinking and leadership into meaningful learning experiences including training at all levels. Pherson provides intelligence professionals to help organizations build analytic cultures and teach and mentor a variety of intelligence tradecraft topics. We engage in analytic projects, facilitate use of analytic techniques, and provide strategic and security planning advice. We also develop and deliver leadership training curricula, and provide executive coaching services.

Prime contract obligations by fiscal year, US$, FY2006–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY06FY08FY10FY13FY17FY19FY21FY23$6.47MFY26FY26 so far: $4.09M

Insight Largest year: $6.47M in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$29M since award = $22.9M in FY2021–FY2026 + $6.08M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$17.7M · 61%
  2. District of Columbia$10.2M · 35%
  3. Texas$1.08M · 3.7%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 61% was performed in Virginia. See more on the Contracts tab