Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

JJR Solutions LLC Federal Contracts

Correct this listing

Doing business as JJR SOLUTIONS

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary FTEMBMQ3SGR5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 5BS77· DAYTON, OH· Active registration until May 29, 2027· www.LMIsolutions.com (opens in a new tab)

Part of Lmi Consulting, LLC (opens another page) (parent company) · One of 4 registrations

Overview

Buyers, JJR Solutions and its subcontractors, US$, contracts active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026; subcontractors: reported value since award

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companySubcontractorsVeterans Affairs$146MNavy$99.1MArmy$59.6M8 more$89.7MNAVSUP FLT LOG CTRNORFOLK (N00189)$95M · Navy officeTECHNOLOGYACQUISITION CENTER NJ(36C10B)$73.3M · Veterans Affair…RPO EAST (36C24E)$46.4M · Veterans Affair…27 more offices$179MJJR Solutions LLC$394MMckinsey & Company, Inc. WashingtonD.C.$963K
Awards toSubcontracts toCircle area = dollars

Insight NAVSUP FLT LOG CTR NORFOLK (N00189) is its largest buyer. See more on the Buyers tab

30 buying officesAll 1 subcontractors

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2016–FY2026

$400M

Includes FY2026 so far: $86.7M, still being reported

Subcontracts it reported, on contracts active FY2021–FY2026

$963K

1 subcontractors

Subcontracts it received

$2.96M

from 5 primes

About

From the company's SBA profile, updated Jun 2026

JJR Solutions is a Service Disabled Veteran Owned Small Business (SDVOSB) focused on delivering solutions, products and services to the US Government. The firm is strongly connected to the information technology domain with a particular focus on data.

Prime contract obligations by fiscal year, US$, FY2016–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY16FY17FY18FY19FY20FY21FY22FY23FY24FY25$90.3MFY26FY26 so far: $86.7M

Insight Largest year: $90.3M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$394M since award = $351M in FY2021–FY2026 + $42.8M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Ohio$170M · 43%
  2. Virginia$130M · 33%
  3. Pennsylvania$49.8M · 13%
  4. District of Columbia$14.9M · 3.8%
  5. Colorado$7.35M · 1.9%

6 smaller, $22.3M together.

Circle area = dollarsOutlined: head office state (Ohio)

Insight 43% was performed in Ohio. See more on the Contracts tab