Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Med-prov, LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary Z8A4H8CQP418· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6BXH4· STEVENSVILLE, MD· Active registration until Dec 26, 2026· www.med-prov.com (opens in a new tab)

Overview

Buyers and offices that award Med-prov prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyU.S. Coast Guard$7,712ATC MOBILE(00048) (70Z048)$7,712 · U.S. Coast Guard officeMed-prov, LLC$7,712
Awards toSubcontracts toCircle area = dollars

Insight ATC MOBILE(00048) (70Z048) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2019–FY2026

$11.4K

Subcontracts it received

$2.94M

from 1 prime

About

From the company's SBA profile, updated Dec 2025

Med-Prov, LLC is a specialized Medicare and Medicaid domain expert providing integrated data analytics, RegTech, and IT support services to federal and state government agencies. We deliver advanced data analysis and reporting, clinical quality measurement, payment integrity, and program integrity support, combining deep regulatory knowledge with technical expertise in business analysis, systems analysis, and UI/UX user-driven design. Our services include claims and medical record review, quality program payment analysis, compliance monitoring, and regulatory policy interpretation, supported by Agile project management and SDLC best practices. We also provide patient- and provider-focused training, instructional design, and workforce development aligned with agency mandates, accessibility (ADA) requirements, and evolving regulatory frameworks. Med-Prov bridges healthcare regulation, data science, and technology to support compliant, efficient, and transparent healthcare programs.

Prime contract obligations by fiscal year, US$, FY2019–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY19FY22$7,712

Insight Largest year: $7,712 in FY2022. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Alabama$7,712 · 100%
Circle area = dollarsOutlined: head office state (Maryland)

Insight 100% was performed in Alabama. See more on the Contracts tab