Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Rao Research And Consulting, LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary LDMKMGQL9M78· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6WQ71· VIENNA, VA· Active registration until Apr 30, 2027· www.raorc.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyFederal HighwayAdministration$3.71M693JJ3 ACQUISITION AND GRANTS MGT$3.71M · Federal Highway Administratio…Rao Research And Consulting, LLC$3.71M
Awards toSubcontracts toCircle area = dollars

Insight 693JJ3 ACQUISITION AND GRANTS MGT is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2015–FY2026

$3.71M

About

From the company's SBA profile, updated May 2026

Rao Research and Consulting, LLC is a research, innovation, and technology transfer company serving in the broad area of transportation facilities. We develop advanced processes and products for federal, state, and local clients to improve system performance and increase the service lives of highway transportation infrastructure. Our project findings and deliverables are based on sound technical concepts, and validated with field, experimental, and case studies data. Our experience is in research and technology transfer in the field of transportation facilities covering areas of materials, pavement analysis and design, bridges, performance modeling, AI applications, QA, nondestructive testing, and value engineering. Our research portfolio includes projects supported by the FHWA, NCHRP, FAA, State DOTs, and industry organizations. We’ve conducted seminal analytical and experimental research advancing the knowledge domain and have directly supported implementation by practitioners.

Prime contract obligations by fiscal year, US$, FY2015–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY15FY17FY18$2.32MFY19FY21FY22FY24−$5,746

Insight Largest year: $2.32M in FY2018; since FY2021, −$5,746 in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$3.71M since award = −$334K in FY2021–FY2026 + $4.04M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Illinois$3.71M · 100%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 100% was performed in Illinois. See more on the Contracts tab